PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10024006m
Common NameEUTSA_v10024006mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 423aa    MW: 49614.3 Da    PI: 6.0039
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10024006mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.14.4e-16161366128
              NAM   6 rFhPtdeelvveyLkkkvegkkleleevikev..diykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                      r +P de ++++yL+  +++ k   ++++++v  ++y+ +Pw +    +a++ ++  F++++++ a   r+     sg W+  g+dk ++s+ +
  Thhalv10024006m  16 RIEPADEVIISYYLNMMINNGKSWPSHFFRDVygHVYNRNPWIFF---NAQSPNYLIFVQTRTE-AC-GRTDDGCGSGCWRIIGRDKVIKSEeT 104
                      679***************99996665789999888********95...3344555556555444.34.47777789**************9867 PP

              NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                      g+  g kk+L f +++++++ek  Wvm+eyrl
  Thhalv10024006m 105 GKFLGFKKILKFCEKEKNRSEKRIWVMEEYRL 136
                      778***************************98 PP

2NAM29.12.8e-0931338357128
              NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++  F+k+ +++a+  r+     +g W+  g+dk ++s+ +g+  g k++L f +++ +++e+  Wvm+e+rl
  Thhalv10024006m 313 NYMVFVKS-RTEAS-GRTDDGCGAGCWRIIGRDKLIKSEeTGKILGFKRILKFCDKEMNRSEERIWVMEEFRL 383
                      33444444.44443.577777799*************98778889**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.48411152IPR003441NAC domain
PfamPF023652.4E-1116136IPR003441NAC domain
SuperFamilySSF1019412.35E-2418150IPR003441NAC domain
PROSITE profilePS5100517.328266399IPR003441NAC domain
PfamPF023653.5E-7275383IPR003441NAC domain
SuperFamilySSF1019413.01E-15275396IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MEEDHSVLSV DDDDQRIEPA DEVIISYYLN MMINNGKSWP SHFFRDVYGH VYNRNPWIFF  60
NAQSPNYLIF VQTRTEACGR TDDGCGSGCW RIIGRDKVIK SEETGKFLGF KKILKFCEKE  120
KNRSEKRIWV MEEYRLVIKR KQNQVICKIR LLPSRKVSSL LAKHFSFLDN RNDWLSDFFV  180
PWRLIRYSFQ HYEIFFFFLF NPINRISSLK EEGMGDHSVS SEGMGENSVS SEGMGENSVS  240
FEDDDDQIEQ AEEQGMKVEY YISSSEDDDE RIPATDERVI SHHLNMMIND SWPHEYVYDL  300
NSWTTFNNTP NPNYMVFVKS RTEASGRTDD GCGAGCWRII GRDKLIKSEE TGKILGFKRI  360
LKFCDKEMNR SEERIWVMEE FRLFDKRKQD QVMCTIELLH LPKVSALLAK HFSFLPKKMM  420
LG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392172.10.0hypothetical protein EUTSA_v10024006mg
TrEMBLV4KPZ10.0V4KPZ1_EUTSA; Uncharacterized protein
STRINGBra029571.1-P1e-51(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37041459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G60280.11e-44NAC domain containing protein 23